PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Jcr4S01066.40
Common NameJCGZ_20918, LOC105628427
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Crotonoideae; Jatropheae; Jatropha
Family Nin-like
Protein Properties Length: 984aa    MW: 108107 Da    PI: 5.2225
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Jcr4S01066.40genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK92.53.1e-29600650252
         RWP-RK   2 ekeisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                    ek++sl++l++yFs+++kdAAk++gvc+T+LKriCRq+GI+RWP+Rki+++
  Jcr4S01066.40 600 EKNVSLSVLQQYFSGSLKDAAKSIGVCPTTLKRICRQHGISRWPSRKINKV 650
                    89***********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151916.881589670IPR003035RWP-RK domain
PfamPF020422.6E-26602650IPR003035RWP-RK domain
Gene3DG3DSA:3.10.20.2401.5E-24881964No hitNo description
SuperFamilySSF542775.23E-23881967No hitNo description
PROSITE profilePS5174523.564885967IPR000270PB1 domain
SMARTSM006661.9E-23885967IPR000270PB1 domain
CDDcd064071.41E-31886966No hitNo description
PfamPF005645.1E-18886966IPR000270PB1 domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 984 aa     Download sequence    Send to blast
MENPFSSNEK GISYFASPRA QADSMVPPDG GTRNSIPEDV FNNFSEFMNM DTYAGWCNSP  60
SAADQMFSSY GFSSFQSTPC ASFDALNIPE HNSSTFLVGG DAFNDAGTYY SCGDKMVIQQ  120
STSQFVYPSD SVGADDSGAK QSDGAHRQRF ISDMAEIAKP VGLSLDEKML RALSMLKETA  180
GGGILAQVWV PIRRGEQYIL STFEQPYLLD QALAGYREVS RTYTFSAEMK PDLPLGLPGR  240
VFISKVPEWT SNVIYYSNTE YLRVKHALNH KVQGSIALPI FEPLDMSCCA VLELVTVKEK  300
PDFDSEMENV CYALQAVNLR TTAPPRLLTQ TLSRNQRAAL AEITDVLRAV CYAHSLPLAL  360
TWIPCNYAEE AVDEIVKVRV KDGHSRSTGK SVLCIEGTAC YVNDREMQGF VHACLEHYIE  420
EGQGIAGKAV QSNHPFFFPD VKAYDITEYP LVHHARKYGL NAAVAIRLRS TYTGDDDYIL  480
EFFLPVNIKG SSEQQLLLNN LSSTMQRICK SLRTVSDAEL ERGGGSTVGF QKGTVPSFSP  540
MLVSTRSCQP TDTVSHLNLA DRITFDASSS KNDRMESDGT HEQMMDGPRR QPEKKRSTSE  600
KNVSLSVLQQ YFSGSLKDAA KSIGVCPTTL KRICRQHGIS RWPSRKINKV NRSLRKIQTV  660
LDSVQGVEGG LKFDPTTGGF VAAGSIIQDS DHQKSFAFHD KQLPAGNSES ANEDAVSVPP  720
APCIDGDNST VKVEEDEFCI DTSRGLMMKS SIPVIDYSED SRSVATDAGI CQEAGLGCRR  780
WSCLENSSAL AKGRKWGLNI VSMKLENSDT HITSRSSCSL AAAESDTKIE GDNGTVDHNQ  840
HTCSSMTDSS NGSGSIMHGS ASSSPSFEGE KQSNVITGYE DSGQKITVKA TYKEDTIRFK  900
FDPFMGCFQL YEEVAKRFKL QNGTFQLKYL DDEREWVMLV SDSDLQECVE ILDYIGAHTV  960
KFLVRDTPLT MGSSGSSNCF LGGS
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012065227.10.0PREDICTED: protein NLP9
SwissprotO228640.0NLP8_ARATH; Protein NLP8
TrEMBLA0A067L9J40.0A0A067L9J4_JATCU; Uncharacterized protein
STRINGPOPTR_0017s04980.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF34643465
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G43500.20.0Nin-like family protein
Publications ? help Back to Top
  1. Zhang L, et al.
    Global analysis of gene expression profiles in physic nut (Jatropha curcas L.) seedlings exposed to salt stress.
    PLoS ONE, 2014. 9(5): p. e97878
    [PMID:24837971]